PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00956.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 333aa    MW: 37052 Da    PI: 7.2203
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00956.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.44.1e-10191249563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              kr++r   NR +A rs +RK  ++ eLe+kv++L++e ++L  ++ +l+   + l++e+
  Rsa1.0_00956.1_g00001.1 191 KRAKRILANRQSAARSKERKIRYTGELERKVQTLQNEATTLSAQVTMLQRGTSDLTTEN 249
                              9*********************************************9999888888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-15187251IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.553189252IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.4E-11191245No hitNo description
SuperFamilySSF579591.27E-10191241No hitNo description
PfamPF001702.0E-8191249IPR004827Basic-leucine zipper domain
CDDcd147036.18E-21192240No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEPSRRANNQ SSILSEIERM PEAPRQRTSH HRRARSDTFF STESINDLLL FDPSDVVDFS  60
SLDFLNAPQP QPSPMMSVDS PPPEETSSSN GAPPPIPLPH GRHVRSFSVD SDSDFFFDDL  120
TATEDNQFAR PTTSSGERKG HHRSNSMDGA TSSGSFDMES ILAAVNCKEG GKKNMGMASD  180
RLAELALLDP KRAKRILANR QSAARSKERK IRYTGELERK VQTLQNEATT LSAQVTMLQR  240
GTSDLTTENK HLKMRLQALQ QQAELRDALN ETLREELNRL RIAAGEISQG NANSYNCTQF  300
SSQQSTMNQL GSNKNQQMST NGQPSFLDFT KRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR5374340.0KR537434.1 Brassica napus cultivar SLM046 VirE2-interacting protein 1 (VIP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586120.10.0PREDICTED: transcription factor VIP1-like
SwissprotQ9MA751e-163VIP1_ARATH; Transcription factor VIP1
TrEMBLA0A0D3CFD40.0A0A0D3CFD4_BRAOL; Uncharacterized protein
STRINGBra032191.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79932639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.11e-130VIRE2-interacting protein 1